PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_26169A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 197aa    MW: 22027.9 Da    PI: 8.9558
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_26169AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.6e-171462148
                               TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                               +g+W++eEd +l++ ++++G+g +W + +++ g++R++k+c++rw++yl
  Oropetium_20150105_26169A 14 KGPWSPEEDAKLKEFIEKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                               79*********************************************97 PP

2Myb_DNA-binding36.11.5e-1169111246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                g +T+ Ed  +    +  G++ W+ Ia+ ++ gRt++++k++w++
  Oropetium_20150105_26169A  69 GEFTEHEDRVICSMYASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                                78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.884966IPR017930Myb domain
SuperFamilySSF466894.08E-2811109IPR009057Homeodomain-like
SMARTSM007179.4E-131364IPR001005SANT/Myb domain
PfamPF002494.2E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-241569IPR009057Homeodomain-like
CDDcd001676.06E-101662No hitNo description
PROSITE profilePS5129415.81867117IPR017930Myb domain
SMARTSM007175.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.2E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDAKLKEFIE KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FTEHEDRVIC SMYASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLYSN  120
NGGSMDQHDT RSLLQLQEHF QAQVPVEYNY DEIKQLLMSS SAAAGNNLHG DQQVHHDGGG  180
MVEGLVGASQ GKVTMM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3172157e-40HQ317215.1 Miscanthus sinensis clone MSSR25 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975125.15e-85PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL25e-75MYB36_ARATH; Transcription factor MYB36
TrEMBLK3Y8T56e-85K3Y8T5_SETIT; Uncharacterized protein
STRINGSi010627m2e-84(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-76myb domain protein 36